The short version of quality control fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-11-02. Anything still debated is marked as such rather than presented as settled.
Chromatographic separation resolves truncated, oxidized, deamidated, and epimerized peptide variants when their retention times differ from the target. Mass spectrometry confirms molecular mass and can reveal modifications that UV detection misses. Liquid chromatography coupled to mass spectrometry combines separation with identity information, which helps distinguish a pure target from a co-eluting impurity. UV-based area percent can overestimate purity if an impurity lacks a chromophore or if the target and impurity have similar response factors. Researchers often report both chromatographic purity and mass confirmation to give a fuller picture.
Additional techniques address components that reversed-phase chromatography may not resolve. Ion-exchange chromatography separates by charge, size-exclusion chromatography detects aggregates, and capillary electrophoresis offers high separation efficiency. Water content is measured by Karl Fischer titration, residual solvents by gas chromatography, and elemental impurities by inductively coupled plasma mass spectrometry. Amino acid analysis or nitrogen determination can estimate peptide content on a mass basis. Purity is frequently reported as area percent, yet standardized comparison across laboratories remains an open question because methods and reporting practices differ.
Peptide purity specifications describe the minimum acceptable result from a defined test. A certificate of analysis may list HPLC purity, mass spectrometry identity, appearance, and counterion content. Specifications are method-dependent, so a value obtained with one gradient or wavelength may differ from another. For research use, common thresholds include 95% and 98% by RP-HPLC, but the appropriate limit depends on the application. The specification should always name the analytical method and acceptance criterion.
Quality control includes system suitability, blank injections, and reference standards. System suitability checks column performance and retention time reproducibility, while blank runs detect carryover or mobile-phase contaminants. Reference standards help calibrate retention time and detector response. Without these controls, a purity value is difficult to compare across laboratories or over time. Documentation of instrument settings and integration parameters is also part of quality control, and acceptance criteria should be set before samples are analyzed.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized peptides commonly appear as powders; color can vary with sequence. |
| Solubility class | Variable; often soluble in water or aqueous buffer | Depends on sequence, charge, and hydrophobicity. |
| Typical storage temperature | -20 °C or lower | Desiccated and protected from light; avoid repeated freeze-thaw cycles. |
| Typical analytical method | Reversed-phase HPLC with UV detection | Often paired with mass spectrometry for identity confirmation. |
| Common synonyms | Peptide purity analysis; peptide purity assay | Used in certificate of analysis and quality control contexts. |
Analytical quality control compares a stored sample against a baseline profile. Reverse-phase chromatography remains common, but stability studies may also use mass spectrometry to detect oxidation, deamidation, or truncation products. Accelerated aging at elevated temperature can reveal degradation pathways, although extrapolation to room temperature is uncertain. Forced degradation studies expose peptides to heat, light, acid, base, and oxidants to identify likely breakdown products. Documentation should record lot number, storage history, and the exact method used for each measurement.
Handling practices reduce the risk of contamination and degradation. Hygroscopic peptides should be equilibrated to room temperature before opening to prevent condensation on the powder. Weighing and reconstitution in a controlled environment limit exposure to moisture and airborne particles. Aliquotting reconstituted solutions avoids repeated freeze-thaw cycles that can cause aggregation or precipitation. When a purity specification is not met, investigation may consider synthesis byproducts, purification losses, storage conditions, and analytical variability rather than a single cause.
Peptide purity can change during storage, handling, and reconstitution, and lyophilized peptides are generally more stable than solutions because water promotes hydrolysis and aggregation. Residual moisture, oxygen, and trace metals can accelerate degradation even in solid form. Temperature fluctuations during shipping may cause condensation and local moisture uptake. Quality control therefore includes appearance, water content, and analytical testing before and after storage challenges. Peptides containing cysteine, methionine, or tryptophan are especially susceptible to oxidation, while asparagine and glutamine residues can deamidate under neutral or alkaline conditions.
Peptide purity specifications describe which tests define an acceptable lot and how results are reported. A certificate of analysis commonly lists a reverse-phase HPLC purity value, a mass spectrometry identity result, water content, counterion content, and residual solvent data. The specification may set a minimum area percent, such as 95% or 98%, depending on the intended use and grade. No universal threshold applies to all peptides, because sequence length, hydrophobicity, and manufacturing route influence achievable purity.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
Reversed-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. Separation depends on interactions between peptide residues and a hydrophobic stationary phase, with gradients of water and organic solvent. Ultraviolet detection near 214 nm responds to the peptide backbone and to many related impurities. The resulting chromatogram is often expressed as area percent, which reports the proportion of peak area assigned to the main component. Different columns, gradients, and wavelengths can produce different purity values for the same material.
Mass spectrometry provides complementary information about molecular identity and certain impurities. Electrospray ionization and matrix-assisted laser desorption/ionization are common ionization techniques for peptides. A measured mass close to the expected value supports correct sequence length and modifications, while extra mass signals can reveal truncations, adducts, or incomplete deprotection. Mass spectrometry alone is not a quantitative purity assay, because ionization efficiency varies between compounds. Coupling liquid chromatography to mass spectrometry links retention time with mass and helps assign peaks that ultraviolet detection records.
Orthogonal separation methods address impurities that RP-HPLC may not resolve. Size-exclusion chromatography detects aggregates and higher-order species, while ion-exchange chromatography separates charge variants. Capillary electrophoresis can assess charge-to-mass ratios and, in some formats, size-based impurities. Amino acid analysis and nitrogen determination estimate peptide content rather than chromatographic purity. Because each technique has a different selectivity, a complete purity profile usually combines results from more than one method. The choice of method depends on the impurity classes of concern.
A balloon pops when the material that makes up its surface tears or shreds, creating a hole. Normally, there is a balance of the balloon skin's elastic tension in which every point on the balloon's surface is being pulled by the material surrounding it. However, if a hole is made on the balloon's surface, the force becomes imbalanced, since there is no longer any force exerted by the center of the hole on the material at its edge. As a result, the balloon's surface at the edge of the hole pulls away, making it bigger; the high pressure air can then escape through the hole and the balloon pops. A balloon can be popped by either physical or chemical actions. Limpanuparb et al. use popping a balloon as a demonstration to teach about physical and chemical hazards in laboratory safety.
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
an intermediate or building block in the synthesis of non-ionic and other surfactants and related functional additives; a component of lubricant and plastic additive systems, including thermoplastic polyurethanes, where long-chain alcohols are used to modify flexibility and permeability; a minor constituent of policosanol-type mixtures employed in cosmetics and personal-care products as part of the lipid phase of creams and emulsions. Because of its chain length and structural similarity to other fatty alcohols, 1-heneicosanol is also used as a reference compound and analytical standard in studies of plant waxes, policosanol mixtures and related lipid fractions. Available safety data sheets describe 1-heneicosanol as a low-volatility solid that is not classified as hazardous under European CLP regulations, but which may cause mild irritation to the skin, eyes and respiratory tract on contact or inhalation of dust. Standard laboratory precautions such as avoiding dust formation, using local exhaust ventilation and wearing eye and skin protection are recommended.
Patients with Type II diabetes will have elevated glucagon levels during a fast and after eating. These elevated glucagon levels over stimulate the liver to undergo gluconeogenesis, leading to elevated blood glucose levels. Consistently high blood glucose levels can lead to organ damage, neuropathy, blindness, cardiovascular issues and bone and joint problems. It is not entirely clear why glucagon levels are so high in patients with Type II diabetes. One theory is that the alpha cells have become resistant to the inhibitory effects of glucose and insulin and do not respond properly to them. Another theory is that nutrient stimulation of the gastrointestinal tract, thus the secretion of gastric inhibitory polypeptide and Glucagon-like peptide-1, is a very important factor in the elevated secretion of glucagon.
After a vascular injury occurs, platelets are activated by locally exposed collagen (glycoprotein (GP) VI receptor), locally generated thrombin (PAR1 and PAR4 receptors), platelet-derived thromboxane A2 (TxA2) (TP receptor) and ADP (P2Y1 and P2Y12 receptors) that is either released from damaged cells or secreted from platelet dense granules. The von Willebrand factor (VWF) serves as an essential accessory molecule. In general terms, platelet activation initiated by agonist takes to a signaling cascade that leads to an increase of the cytosolic calcium concentration. Consequently, the integrin αIIbβ3 is activated and the binding to fibrinogen allows the aggregation of platelets to each other. The increase of cytosolic calcium also leads to shape change and TxA2 synthesis, leading to signal amplification.
With the merger of the laboratories into a single entity, the history offices at each site ceased to maintain independent histories and all history functions were transferred to a central History Office located at AFRL HQ at Wright-Patterson AFB. In homage to the predecessor laboratories, the new organization named four of the research sites after the laboratories and assured that each laboratory's history would be preserved as inactivated units. In 2023, the National Advanced Air Mobility Center of Excellence was completed to help the Laboratory, private companies, and local academics collaborate on the research of eVTOL and UAS aircraft.
Sources: en.wikipedia.org
Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).
Fatty change, or steatosis, is the accumulation of fatty acids in liver cells. This can be seen as fatty globules under the microscope. Alcoholism causes development of large fatty globules (macro-vesicular steatosis) throughout the liver and can begin to occur after a few days of heavy drinking. Alcohol is metabolized by alcohol dehydrogenase (ADH) into acetaldehyde, then further metabolized by aldehyde dehydrogenase (ALDH) into acetic acid, which is finally oxidized into carbon dioxide (CO2) and water (H2O). This process generates NADH, and increases the NADH/NAD+ ratio. A higher NADH concentration induces fatty acid synthesis while a decreased NAD level results in decreased fatty acid oxidation. Subsequently, the higher levels of fatty acids signal the liver cells to compound it to glycerol to form triglycerides. These triglycerides accumulate, resulting in fatty liver.
Another common example is the reaction of a primary amine or secondary amine with a carboxylic acid or with a carboxylic acid derivative to form an amide. This reaction is widely used, especially in the synthesis of peptides. On the simple addition of an amine to a carboxylic acid, a salt of the organic acid and base is obtained. To overcome this, the carboxylic acid first needs to be "activated". This is usually done by converting the acid into a more reactive derivative (i.e. anhydride, acid halide) or by using a coupling agent. In some cases, high temperatures (>200 °C) can overcome salt formation by driving off water, without the need for "activation" of the carboxyl group. The downside to this simple reaction is that the compounds may decompose at these elevated temperatures. The carboxylic acid derivatives can be esters, anhydrides, acid halides or any other activated species. The choice of activated carboxyl group or coupling agent can be very important in peptide synthesis, as using the wrong one can lead to racemization.
Sources: en.wikipedia.org
It usually refers to the relative peak area of the target peptide in a chromatogram, not the mass fraction of the entire sample. Different analytical methods can yield different purity values. Water, counterions, and residual solvents are excluded unless the calculation specifies otherwise.
A single method can miss co-eluting impurities, salts, water, or structural modifications. Orthogonal techniques separate compounds by different properties, such as hydrophobicity, charge, or size. Combining results gives a more complete assessment of sample composition.
No, purity measures the amount of target relative to other peaks, not the identity or sequence of the target. Mass spectrometry and sequencing may be needed to confirm structure. A high-purity sample can still contain a peptide with an incorrect sequence.
It is a document reporting test results for a specific lot, often including appearance, HPLC purity, mass identity, and storage conditions. It should identify the analytical method and acceptance criteria. The certificate describes the tested sample, not necessarily every vial.