visceral adipose tissue comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-08-05. Where a claim depends on a specific study, the study is described rather than over-claimed.
Tesamorelin is a synthetic analog of growth hormone-releasing hormone, a peptide hormone produced by the hypothalamus. The molecule retains the 44-amino-acid sequence of human GHRH and carries a trans-3-hexenoyl modification at its N-terminus. This modification increases resistance to enzymatic degradation and extends the peptide's functional stability relative to native GHRH. The compound is supplied as a lyophilized powder for reconstitution and subcutaneous administration in clinical settings. Its development code was TH9507, and it belongs to the GHRH analog class. It is not a growth hormone product; instead, it acts upstream to stimulate endogenous growth hormone release.
Clinical interest in tesamorelin arose from the need to address visceral adiposity in people living with HIV. Antiretroviral therapy improved survival but was associated in some patients with central fat accumulation, altered lipid profiles, and metabolic complications. This condition, often called HIV-associated lipodystrophy, involves excess visceral adipose tissue that is difficult to manage through diet and exercise alone. Investigators evaluated tesamorelin because GHRH analogs can stimulate growth hormone secretion and influence fat distribution without direct liposuction or invasive procedures.
Insulin-like growth factor 1 is produced largely in the liver in response to growth hormone signaling. Its concentration shifts over days rather than minutes, which makes it practical for tracking changes across a study period. Interpretation still depends on age, nutritional status, and concurrent illness, all of which independently affect the marker. Reference ranges are therefore stratified, and comparisons are usually made within an individual over time rather than against a single population threshold.
Assays for these markers differ in calibration and antibody specificity, so results from different platforms are not always interchangeable. Reported values can shift when a laboratory changes method, even without any biological change. Studies that span long periods or multiple sites often need cross-validation of assays. This methodological variability is a recognized limitation when comparing findings across published reports, and it remains a topic of ongoing standardization work.
| Property | Value | Notes |
|---|---|---|
| Molecular weight | Approximately 5,136 Da | Based on the 44-amino-acid peptide backbone and N-terminal modification. |
| Appearance | White to off-white lyophilized powder | Usually supplied in single-use vials for reconstitution. |
| Solubility | Freely soluble in water; slightly soluble in some organic solvents | Peptide nature supports aqueous reconstitution. |
| Typical storage | 2–8 °C, protected from light | Refrigeration reduces degradation; avoid freezing unless specified. |
| Common analytical method | Reverse-phase high-performance liquid chromatography | Used for identity, purity, and quantification. |
| Synonyms | Tesamorelin, TH9507, GHRH(1-44) analog | Generic descriptors; avoid proprietary names. |
Tesamorelin is a synthetic peptide of forty-four amino acids whose sequence reproduces human growth hormone-releasing hormone. Its distinguishing feature sits at the amino terminus, where a trans-3-hexenoyl group replaces the free amine. That acylation slows cleavage by dipeptidyl peptidase IV, an enzyme that otherwise removes the first two residues and inactivates the natural hormone quickly. The modified peptide therefore persists longer in circulation while keeping the same receptor target. It is handled as a lyophilized solid and dissolved shortly before use.
Signaling begins at the GHRH receptor, a class B G protein-coupled receptor displayed on somatotroph cells of the anterior pituitary. Receptor occupancy activates Gs proteins, which raise adenylyl cyclase activity and intracellular cyclic AMP, in turn driving protein kinase A dependent pathways. The downstream output is synthesis and pulsatile secretion of growth hormone into the bloodstream. Hepatic tissue and peripheral sites respond by increasing insulin-like growth factor 1 production. Somatostatin and IGF-1 itself supply negative feedback that caps the size and duration of each secretory burst.
Growth hormone released from the pituitary stimulates the liver and other tissues to produce insulin-like growth factor 1, a stable circulating protein that serves as a practical marker of activity. Clinical studies therefore track IGF-1 concentrations alongside the hormone itself, and they commonly measure body composition with imaging rather than relying on body weight alone. Visceral adipose tissue, the fat surrounding abdominal organs, is quantified by computed tomography in the studies that supported approval. Adverse effects reported in trials include injection-site reactions, joint pain, and increases in blood glucose, which is why monitoring accompanies use.
Questions remain about how much of the observed fat reduction reflects direct GHRH-receptor signaling versus the downstream growth hormone and IGF-1 surge. It is also unclear whether the compound produces meaningful benefit in populations without lipodystrophy, since trials in cognitive impairment did not reach their stated goals. Long-term effects on glucose metabolism and on cardiovascular outcomes are not fully characterized. Published work generally describes effects on surrogate markers rather than on hard clinical endpoints, and independent replication of some findings is limited.
Lately Policy and Campaigns Director, United Kingdom Homecare Association. For services to Domiciliary Care. Andrew David Arbuckle. Trustee and Fundraiser, Royal Scottish Agricultural Benevolent Institution. For services to Farming and to the community in Fife. Sarah Elizabeth Armitage. Chair of Trustees, Embark Federation. For services to Education. Paul Robert Arnold. Deputy Chief Executive and Chief Operating Officer, Information Commissioner's Office. For services to Regulation and to Equality, Diversity and Inclusion. Keith Alan Ashcroft. Lately Area Director, Environment Agency. For services to the Environment. Simon Edward Ayers. Chief Executive Officer, TrustMark. For services to Consumer Protection. Jannella Baker. Training Officer, Berkshire Search and Rescue Dogs, Lowland Rescue. For services to Search and Rescue. David Martin James Ball. For services to the community in East Anglia. Sarah Pamela Ballantine. For Charitable Fundraising in Northern Ireland. Tajinder Kaur Banwait. Founder, Urban Apothecary London. For services to Business and to the Beauty Industry. Timothy Paul Barnes. Chair, St George's Garrison Church Trust. For services to the community in the Royal Borough of Greenwich, London. Dr. Catherine Emma Baxter. University Secretary, Harper Adams University. For services to Higher Education. Gina Beard. Lead Cancer Nurse, Hywel Dda University Health Board. For services to Cancer Nursing. Robert Duncan Beaumont. Lately Governor, Ravenscliffe High School and Sports College, Halifax.
Additionally, CAM providers are concerned by the closure of other CAM laboratories under CLIA, and have sought to avoid detection. Some CAM providers and laboratory personnel have not had exposure to laboratory curriculum and are unaware of CLIA requirements. CLIA is largely reliant on laboratories to self-identify themselves for enrollment. Providers of CAM laboratories have opposed CLIA oversight and suggested they be regulated by their peers or by a CAM-specific division. CAM providers have stated that they should be exempt from CLIA since CAM laboratories do not participate in health insurance. Others claim that they are exempt from CLIA because the tests are performed solely for research purposes and not used in patient care and treatment decisions. Several pathologists have stated that CAM testing falls within the scope of their medical license and should not be regulated under CLIA. CLIA provisions are geared towards CLIA-certified laboratories, but not for those that have not enrolled. When a CAM laboratory is found to be operating without a CLIA certificate, they are sent a cease and desist letter to stop testing until the laboratory is CLIA certified. There are no administrative remedies available to CMS when a laboratory refuses to enroll in CLIA and refuses to cease testing. CMS cannot impose monetary or other administrative penalties on laboratories that defy the law, but can only refer cases to other Federal or State agencies.
Understanding the igneous petrology of monazite is important to be able to date the crystallisation age of igneous rocks. Monazite is commonly present as an accessory mineral in low-CaO peraluminous granitoids, from diorites, micaceous granites to pegmatites. The reason for the low CaO content is probably that melts with high CaO content promote the formation of apatite and allanite but not monazite. It is commonly formed from magmatism involving carbonatic melts but not mafic plutons or lavas. Those rocks usually host economic REE ore deposits, making monazite geochronology important in mining exploration. The simplest monazite zonation showing successive crystallisation of melts is concentric zonation, in which new monazite layers are crystallized rim-by-rim around the pre-existing core. The rims often show compositional variations due to the preferential incorporation of certain elements in the crystal lattice. For example, considering a closed system, Th is preferentially incorporated into the monazite mineral structure, leaving a Th-depleted melt. Therefore, older monazite near the core of a grain is rich in Th while younger monazite contains less, resulting in a rimward decrease of Th in a concentric zoning pattern. Investigating composition and age variation of these rims help to constrain the timing and rate of crystallisation as well as the composition of the melt, especially for rocks where zircon is not present.
Sources: en.wikipedia.org
In addition to their role in RNAi, siRNAs can also activate gene expression, a phenomenon termed "RNA activation" or RNAa. This was first observed when synthetic siRNAs, termed "small activating RNA" (saRNA), targeting gene promoters were found to induce potent transcriptional activation of target genes. RNAa has been demonstrated to be a conserved mechanism, observed across species from insects, C. elegans, and plants, to mammals (including humans). The mechanism of RNAa involves the targeting of promoter regions by saRNAs, leading to the recruitment of transcriptional machinery and epigenetic changes that promote gene expression. This process often involves the RNA-induced transcriptional activation (RITA) complex, which includes Argonaute proteins (particularly Ago2), RNA helicase A (RHA), and CTR9. Endogenous miRNAs can also mediate RNAa, expanding the regulatory roles of these small RNAs beyond gene silencing. Several saRNA-based therapeutics are currently in clinical development. MTL-CEBPA, developed by MiNA Therapeutics, targets the CEBPA gene and is in Phase II trials for liver cancer. RAG-01, developed by Ractigen Therapeutics, targets the p21 gene and is in Phase I trials for non-muscle invasive bladder cancer (NMIBC). These clinical trials represent a significant step towards translating the RNAa phenomenon into novel therapeutic strategies.
to protect the tissues that lie beneath from radiation, desiccation, toxins, invasion by pathogens, and physical trauma the regulation and exchange of chemicals between the underlying tissues and a body cavity the secretion of hormones into the circulatory system, as well as the secretion of sweat, mucus, enzymes, and other products that are delivered by ducts to provide sensation Absorb water and digested food in the lining of digestive canal.
=== Laboratory synthesis === Heavy neutron irradiation of plutonium results in four major isotopes of einsteinium: 253Es (α-emitter; half-life 20.47 days, spontaneous fission half-life 7×105 years); 254mEs (β-emitter, half-life 39.3 hours), 254Es (α-emitter, half-life 276 days) and 255Es (β-emitter, half-life 39.8 days). An alternative route involves bombardment of uranium-238 with high-intensity nitrogen or oxygen ion beams. 247Es (half-life 4.55 min) was produced by irradiating 241Am with carbon or 238U with nitrogen ions. The latter reaction was first realized in 1967 in Dubna, Russia, and the involved scientists were awarded the Lenin Komsomol Prize. 248Es was produced by irradiating 249Cf with deuterium ions. It mainly β-decays to 248Cf with a half-life of 25±5 minutes, but also releases 6.87-MeV α-particles; the ratio of β's to α-particles is about 400.
Sources: en.wikipedia.org
The hot filament reaches a temperature of less than 2,500 °C (2,770 K; 4,530 °F), leading to the inability to create atomic ions of species with a high ionization energy, such as osmium and tungsten. Although the TIMS method can create molecular ions instead in this case, species with high ionization energy can be analyzed more effectively with MC-ICP-MS.
== External links == visfatin,+human at the U.S. National Library of Medicine Medical Subject Headings (MeSH) NAMPT human gene location in the UCSC Genome Browser. NAMPT human gene details in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: P43490 (Human Nicotinamide phosphoribosyltransferase) at the PDBe-KB. Overview of all the structural information available in the PDB for UniProt: Q99KQ4 (Mouse Nicotinamide phosphoribosyltransferase) at the PDBe-KB.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
express the short-range order of the liquid, i.e., the correlations between a molecule and "shells" of nearest neighbors, next-nearest neighbors, and so on. An equivalent representation of these correlations is the radial distribution function
Sources: en.wikipedia.org
It is a synthetic peptide analog of human growth hormone-releasing hormone. It is used clinically to reduce excess visceral abdominal fat in adults with HIV-associated lipodystrophy. It works by stimulating pituitary growth hormone release.
Pivotal trials enrolled adults with HIV and excess visceral abdominal fat, often in the context of antiretroviral therapy. Participants were assessed mainly by computed tomography for visceral adipose tissue. The approved indication remains specific to that population.
Long-term effects on cardiovascular events, mortality, and sustained fat distribution are not well established. Most trials measured changes over months rather than years. Open questions also include whether benefits persist after treatment stops.
It varies slowly and reflects cumulative axis activity rather than momentary secretion. Growth hormone is released in pulses affected by sleep, stress, and meals, making single readings hard to interpret. The slower marker gives a more stable picture across a study period.